PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vradi02g06060.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family TCP
Protein Properties Length: 988aa    MW: 109262 Da    PI: 8.6409
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vradi02g06060.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP40.21.2e-122259845
              TCP  8 hskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkds 45
                     ++++hTkv+gR RRv l+ +caar+F+L++eL    +s
  Vradi02g06060.1 22 KKDRHTKVNGRERRVLLPPLCAARIFQLTRELDNEINS 59
                     79******************************876666 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036341.9E-92160IPR005333Transcription factor, TCP
Gene3DG3DSA:3.40.50.3003.2E-47439672IPR027417P-loop containing nucleoside triphosphate hydrolase
CDDcd032132.96E-74441667No hitNo description
PROSITE profilePS5089317.06443684IPR003439ABC transporter-like
SuperFamilySSF525409.58E-42444680IPR027417P-loop containing nucleoside triphosphate hydrolase
PfamPF000056.0E-25463612IPR003439ABC transporter-like
SMARTSM003821.5E-9469670IPR003593AAA+ ATPase domain
PROSITE patternPS002110584598IPR017871ABC transporter, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005524Molecular FunctionATP binding
GO:0016887Molecular FunctionATPase activity
Sequence ? help Back to Top
Protein Sequence    Length: 988 aa     Download sequence    Send to blast
MASTTPVPVK ASNTKLPPLR AKKDRHTKVN GRERRVLLPP LCAARIFQLT RELDNEINSK  60
ETFLPLDFDV FSNFNVEFSA AEIEMLQSLM TRDADWNGAF NFSKDLTFLT ICAQQMKGDI  120
TQRMCTEAEI LAYGQSFGGG KSRSIVLKPN INCNLSSWVN GCEPGWGCKA NQKVDIDSPK  180
KDIPIRSVDC LPCCEGFFCP RGLTCMIPCP LGSYCPLGNL NKTSGVCEPY RYQLPPGKPN  240
HTCGGADIWA DIQSSSEAGL CFLLIIIYNC SDQVLATRER RQASTRERAV QSVRETQARE  300
KWKSAKDIAK KHAVGLQSQL SRTFSRKTSK KPELKGFGSK HSDSAIPPKG KKKDKNNLSK  360
ILNDIEQNPD NPEGFNVEIG DKNVKKQAPR GKQLHTQSQI FKYAYGQIEK EKALAEQNKN  420
LTFSGVISMA SDIEIRKRPT IEVAFKDLTL TLKGKNKHLL RCVTGKLYPG RVSAVMGPSG  480
AGKTTFLSAL TGKATGCHTT GQVHVNGQES SIRSYKKIIG FVPQDDIVHG NLTVEENLWF  540
SARCRLPADL PKEEKVLVVE RVIESLGLQA IRDSLVGTVE KRGISGGQRK RVNVGLEMVM  600
EPSLLILDEP TSGLDSSSSQ LLLRALRREA LEGVNICMVL HQPSYTLFKM FDDFILLAKG  660
GLTVYHGPVN KVEEYFSSMG INVPDRVNPP DYFIDILEGI VKLSPSLGVT YKQLPVRWML  720
HNGYPVPMDM LQSVEGMSAP SGEGSSSGAA TGGEEQAPSF AGELWQDVKC NVEMKKDILH  780
INFLASHDLS NRVTPGVFNQ YKTQAVDFLI LLLAGLCLGT LAKVSDESFG ATGYTYTVIA  840
IAALRSFSLD KLHYWRESSS GMSSLAYFLS KDTVDHFSTI IKPLVYLSMF YFFNNPRSSV  900
VDNYIVLLCL VYCVTGIAYV LAIFLQPGPA QLWSALLPVV LTLVATYQNE DDSKYVKYLS  960
DLCYTKWALE AFVISNAKRP SYRDGNN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5do7_B1e-4146669696326ATP-binding cassette sub-family G member 8
5do7_D1e-4146669696326ATP-binding cassette sub-family G member 8
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150390.0AP015039.1 Vigna angularis var. angularis DNA, chromosome 6, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014522341.10.0PREDICTED: ABC transporter G family member 28
SwissprotQ9FF460.0AB28G_ARATH; ABC transporter G family member 28
TrEMBLA0A0L9TE160.0A0A0L9TE16_PHAAN; Uncharacterized protein
STRINGGLYMA11G20220.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF91422
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47620.13e-11TEOSINTE BRANCHED, cycloidea and PCF (TCP) 14